PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10004455
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family GRF
Protein Properties Length: 364aa    MW: 41009.4 Da    PI: 8.8275
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10004455genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC68.21.1e-2183127144
          WRC   1 daepgrCrRtDGKkWRCsrrv.legkklCErHlhrgrsrsrkske 44 
                  d+epgrCrRtDGKkWRCs++  ++++k+CE+H+hrg++rsrk++e
  Lus10004455  83 DPEPGRCRRTDGKKWRCSKESnYPNSKYCEKHMHRGKNRSRKPVE 127
                  79***************98753899*****************997 PP

2QLQ58.71.7e-202455233
          QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlq 33
                  FTa+Q+q+L++Q+l+yKy+++++P+Pp+Ll+
  Lus10004455 24 IFTATQWQELEHQALIYKYMVSGVPIPPQLLF 55
                 6*****************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.3E-112359IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.2952459IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.4E-152455IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166722.40283128IPR014977WRC domain
PfamPF088791.2E-1784127IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MKMDARGEEG NPRGLLSSSH HHPIFTATQW QELEHQALIY KYMVSGVPIP PQLLFSTVSS  60
SSLRYPRVGE VGYFQVGNGK KGDPEPGRCR RTDGKKWRCS KESNYPNSKY CEKHMHRGKN  120
RSRKPVEISP SSSLTNMNLV NPSSYPLISP VLSSTSLDQS PHLHPVPNIH YHTGLLNPNF  180
IYPHHNSSSS SSSSSSSRDW SNKPNLGSEF SPRSTTHNNL FLEPPVTSSP SDKDYRYFNG  240
MRNYHNIDKQ QHQLISTTRK LGYCSPQSEF ESFYNCYPSK QQQQEEKHCF VLGADFKSSS  300
SEIRPVKVEN YSSNEEICQS ISPPSADHRE QFHKPLHHFF GIGGGNNCSD SWLDLASTST  360
RPS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF97443137
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.19e-43growth-regulating factor 5